AHCY Rabbit mAb, Clone: [ARC2674], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2756S
Artikelname: AHCY Rabbit mAb, Clone: [ARC2674], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2756S
Hersteller Artikelnummer: CNA2756S
Alternativnummer: MBL-CNA2756S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AHCY (P23526).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2674]
Molekulargewicht: 48kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AHCY (P23526).
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000