Acetyl-Histone H3-K23 Rabbit mAb, Clone: [ARC2683], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2770S
Artikelname: Acetyl-Histone H3-K23 Rabbit mAb, Clone: [ARC2683], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2770S
Hersteller Artikelnummer: CNA2770S
Alternativnummer: MBL-CNA2770S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K23 of human Histone H3 (P68431).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2683]
Molekulargewicht: 16kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target-Kategorie: A synthetic acetylated peptide around K23 of human Histone H3 (P68431).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200