Acetyl-Histone H3-K27 Rabbit mAb, Clone: [ARC53670], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA2771P
Artikelname: Acetyl-Histone H3-K27 Rabbit mAb, Clone: [ARC53670], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA2771P
Hersteller Artikelnummer: CNA2771P
Alternativnummer: MBL-CNA2771P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, DOT, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K27 of human Histone H3 (P68431).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC53670]
Molekulargewicht: 15kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target-Kategorie: A synthetic acetylated peptide around K27 of human Histone H3 (P68431).
Application Verdünnung: WB: DB,1:500 - 1:2000|WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200|IF/ICC,1:50 - 1:200|ChIP,1:50 - 1:200|CUT&Tag, 105 cells /2 µg