ARL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2830T
Artikelname: ARL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2830T
Hersteller Artikelnummer: CNA2830T
Alternativnummer: MBL-CNA2830T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human ARL2 (NP_001658.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human ARL2 (NP_001658.2).
Application Verdünnung: WB: WB,1:500 - 1:2000