DRD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA2893P
| Artikelname: |
DRD1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA2893P |
| Hersteller Artikelnummer: |
CNA2893P |
| Alternativnummer: |
MBL-CNA2893P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 338-446 of human DRD1 (NP_000785.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
49kDa |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT |
| Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 338-446 of human DRD1 (NP_000785.1). |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
