EPOR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2917P
Artikelname: EPOR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2917P
Hersteller Artikelnummer: CNA2917P
Alternativnummer: MBL-CNA2917P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EPOR (NP_000112.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EPOR (NP_000112.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200