SLC16A4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3016S
Artikelname: SLC16A4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3016S
Hersteller Artikelnummer: CNA3016S
Alternativnummer: MBL-CNA3016S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC16A4 (NP_004687.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC16A4 (NP_004687.1).
Application Verdünnung: WB: WB,1:500 - 1:1000