Flotillin 1 Rabbit mAb, Clone: [ARC0765], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3023S
Artikelname: Flotillin 1 Rabbit mAb, Clone: [ARC0765], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3023S
Hersteller Artikelnummer: CNA3023S
Alternativnummer: MBL-CNA3023S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin 1 (O75955).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0765]
Molekulargewicht: 47kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin 1 (O75955).
Application Verdünnung: WB: WB,1:500 - 1:2000| IHC-P,1:50 - 1:200