CKMT1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3046T
Artikelname: CKMT1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3046T
Hersteller Artikelnummer: CNA3046T
Alternativnummer: MBL-CNA3046T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|IP,1:500 - 1:1000