GRIN2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3056S1
Artikelname: GRIN2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3056S1
Hersteller Artikelnummer: CNA3056S1
Alternativnummer: MBL-CNA3056S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1185-1484 of human GRIN2B (NP_000825.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 166kDa
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: DKHGVVSGVPAPWEKNLTNVEWEDRSGGNFCRSCPSKLHNYSTTVTGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1185-1484 of human GRIN2B (NP_000825.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200