PARD6A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA3064T
Artikelname: |
PARD6A Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA3064T |
Hersteller Artikelnummer: |
CNA3064T |
Alternativnummer: |
MBL-CNA3064T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
37kDa |
Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS |
Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6). |
Application Verdünnung: |
WB: WB,1:500 - 1:2000 |