PAX2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3067P
Artikelname: PAX2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3067P
Hersteller Artikelnummer: CNA3067P
Alternativnummer: MBL-CNA3067P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human PAX2 (NP_003978.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human PAX2 (NP_003978.3).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200