PFN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3074S
Artikelname: PFN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3074S
Hersteller Artikelnummer: CNA3074S
Alternativnummer: MBL-CNA3074S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-140 of human PFN2 (P35080).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 15kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: NVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-140 of human PFN2 (P35080).
Application Verdünnung: WB: WB,1:500 - 1:2000