Rad50 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3078S
Artikelname: Rad50 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3078S
Hersteller Artikelnummer: CNA3078S
Alternativnummer: MBL-CNA3078S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad50 (NP_005723.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 154kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad50 (NP_005723.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:20 - 1:50