SOX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3086P
Artikelname: SOX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3086P
Hersteller Artikelnummer: CNA3086P
Alternativnummer: MBL-CNA3086P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 292-391 of human SOX1 (NP_005977.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 292-391 of human SOX1 (NP_005977.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200