SUMO4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3100S
Artikelname: SUMO4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3100S
Hersteller Artikelnummer: CNA3100S
Alternativnummer: MBL-CNA3100S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 11kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6).
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:300