APP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3161S
Artikelname: APP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3161S
Hersteller Artikelnummer: CNA3161S
Alternativnummer: MBL-CNA3161S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (P05067).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 87kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKR
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (P05067).
Application Verdünnung: WB: WB,1:500 - 1:2000