DNMT3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3169T
Artikelname: DNMT3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3169T
Hersteller Artikelnummer: CNA3169T
Alternativnummer: MBL-CNA3169T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DNMT3A (NP_072046.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 102kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DNMT3A (NP_072046.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:20