TFAM Rabbit mAb, Clone: [ARC51776], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3173P
Artikelname: TFAM Rabbit mAb, Clone: [ARC51776], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3173P
Hersteller Artikelnummer: CNA3173P
Alternativnummer: MBL-CNA3173P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TFAM (NP_003192.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51776]
Molekulargewicht: 29kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: QDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELY
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TFAM (NP_003192.1).
Application Verdünnung: WB: WB,1:1000 - 1:10000|IHC-P,1:50 - 1:200