[KO Validated] SMARCB1/SNF5 Rabbit mAb, Clone: [ARC53139], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3247P
Artikelname: [KO Validated] SMARCB1/SNF5 Rabbit mAb, Clone: [ARC53139], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3247P
Hersteller Artikelnummer: CNA3247P
Alternativnummer: MBL-CNA3247P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC53139]
Molekulargewicht: 44kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200