NPLOC4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3256S
Artikelname: NPLOC4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3256S
Hersteller Artikelnummer: CNA3256S
Alternativnummer: MBL-CNA3256S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human NPLOC4 (NP_060391.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 68kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human NPLOC4 (NP_060391.2).
Application Verdünnung: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200