CD8B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA3286S
Artikelname: |
CD8B Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA3286S |
Hersteller Artikelnummer: |
CNA3286S |
Alternativnummer: |
MBL-CNA3286S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8B (NP_757362.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
24kDa |
Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
Sequenz: |
LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8B (NP_757362.1). |
Application Verdünnung: |
WB: WB,1:500 - 1:2000 |