KIF5A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3303T
Artikelname: KIF5A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3303T
Hersteller Artikelnummer: CNA3303T
Alternativnummer: MBL-CNA3303T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 117kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2).
Application Verdünnung: WB: WB,1:1000 - 1:3000|IF/ICC,1:50 - 1:200