FOXO4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3307P
Artikelname: FOXO4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3307P
Hersteller Artikelnummer: CNA3307P
Alternativnummer: MBL-CNA3307P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 230-341 of human FOXO4 (NP_005929.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTLNEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTY
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 230-341 of human FOXO4 (NP_005929.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200