CDC27 Rabbit mAb, Clone: [ARC1947], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3333S
Artikelname: CDC27 Rabbit mAb, Clone: [ARC1947], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3333S
Hersteller Artikelnummer: CNA3333S
Alternativnummer: MBL-CNA3333S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1947]
Molekulargewicht: 92kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260).
Application Verdünnung: WB: WB,1:500 - 1:2000