SLC39A7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3343S
Artikelname: SLC39A7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3343S
Hersteller Artikelnummer: CNA3343S
Alternativnummer: MBL-CNA3343S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2).
Application Verdünnung: WB: WB,1:1000 - 1:3000