RPA70/RPA1 Rabbit mAb, Clone: [ARC0773], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3367S
Artikelname: RPA70/RPA1 Rabbit mAb, Clone: [ARC0773], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3367S
Hersteller Artikelnummer: CNA3367S
Alternativnummer: MBL-CNA3367S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IP, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPA70/RPA1 (P27694).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0773]
Molekulargewicht: 68kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPA70/RPA1 (P27694).
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000|ChIP,1:500 - 1:1000