KAT8/MYST1/MOF Rabbit mAb, Clone: [ARC1964], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3390S
Artikelname: KAT8/MYST1/MOF Rabbit mAb, Clone: [ARC1964], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3390S
Hersteller Artikelnummer: CNA3390S
Alternativnummer: MBL-CNA3390S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-458 of human KAT8/MYST1/MOF (Q9H7Z6).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1964]
Molekulargewicht: 52kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 350-458 of human KAT8/MYST1/MOF (Q9H7Z6).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200