Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb, Clone: [ARC2028], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3430S
Artikelname: Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb, Clone: [ARC2028], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3430S
Hersteller Artikelnummer: CNA3430S
Alternativnummer: MBL-CNA3430S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2028]
Molekulargewicht: 35kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200