eIF3e Rabbit mAb, Clone: [ARC1997], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3431S
Artikelname: eIF3e Rabbit mAb, Clone: [ARC1997], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3431S
Hersteller Artikelnummer: CNA3431S
Alternativnummer: MBL-CNA3431S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-350 of human eIF3e (P60228).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1997]
Molekulargewicht: 52kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: QRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 210-350 of human eIF3e (P60228).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200