TBK1/NAK Rabbit mAb, Clone: [ARC0778], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3458S
Artikelname: TBK1/NAK Rabbit mAb, Clone: [ARC0778], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3458S
Hersteller Artikelnummer: CNA3458S
Alternativnummer: MBL-CNA3458S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1/NAK (Q9UHD2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0778]
Molekulargewicht: 84kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1/NAK (Q9UHD2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000