S100A6 Rabbit mAb, Clone: [ARC2005], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3461S
Artikelname: S100A6 Rabbit mAb, Clone: [ARC2005], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3461S
Hersteller Artikelnummer: CNA3461S
Alternativnummer: MBL-CNA3461S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (P06703).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2005]
Molekulargewicht: 10kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (P06703).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200