CRMP5/DPYSL5 Rabbit mAb, Clone: [ARC2020], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3503S
Artikelname: CRMP5/DPYSL5 Rabbit mAb, Clone: [ARC2020], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3503S
Hersteller Artikelnummer: CNA3503S
Alternativnummer: MBL-CNA3503S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 465-564 of human CRMP5/DPYSL5 (Q9BPU6).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2020]
Molekulargewicht: 61kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 465-564 of human CRMP5/DPYSL5 (Q9BPU6).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200