SMC4 Rabbit mAb, Clone: [ARC2042], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3559S
Artikelname: SMC4 Rabbit mAb, Clone: [ARC2042], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3559S
Hersteller Artikelnummer: CNA3559S
Alternativnummer: MBL-CNA3559S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1189-1288 of human SMC4 (Q9NTJ3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2042]
Molekulargewicht: 147kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSVAVNPKEIASKGLC
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1189-1288 of human SMC4 (Q9NTJ3).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200