CoREST/RCOR1 Rabbit mAb, Clone: [ARC2044], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3568S
Artikelname: CoREST/RCOR1 Rabbit mAb, Clone: [ARC2044], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3568S
Hersteller Artikelnummer: CNA3568S
Alternativnummer: MBL-CNA3568S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2044]
Molekulargewicht: 53kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEH
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000|ChIP,1:500 - 1:1000