SHIP1 Rabbit mAb, Clone: [ARC2047], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3571S
Artikelname: SHIP1 Rabbit mAb, Clone: [ARC2047], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3571S
Hersteller Artikelnummer: CNA3571S
Alternativnummer: MBL-CNA3571S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1084-1178 of human SHIP11 (Q92835).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2047]
Molekulargewicht: 133kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1084-1178 of human SHIP11 (Q92835).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200