STING/TMEM173 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3575S1
Artikelname: STING/TMEM173 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3575S1
Hersteller Artikelnummer: CNA3575S1
Alternativnummer: MBL-CNA3575S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-379 of human STING/TMEM173 (NP_938023.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: KGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 150-379 of human STING/TMEM173 (NP_938023.1).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500