[KD Validated] STAT2 Rabbit mAb, Clone: [ARC51796], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA3588P
| Artikelname: |
[KD Validated] STAT2 Rabbit mAb, Clone: [ARC51796], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA3588P |
| Hersteller Artikelnummer: |
CNA3588P |
| Alternativnummer: |
MBL-CNA3588P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC51796] |
| Molekulargewicht: |
98kDa |
| Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequenz: |
KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL |
| Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1). |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
