DOCK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3595T
Artikelname: DOCK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3595T
Hersteller Artikelnummer: CNA3595T
Alternativnummer: MBL-CNA3595T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1551-1830 of human DOCK2 (NP_004937.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 212kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREMPDFDDRRVGRPRSMLRSYRQMSIISLASMNSDCSTPSKPTSESFDLELASPKTPRVEQEEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAAIPLKASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1551-1830 of human DOCK2 (NP_004937.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500