FHL2 Rabbit mAb, Clone: [ARC2068], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA3670S
Artikelname: |
FHL2 Rabbit mAb, Clone: [ARC2068], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA3670S |
Hersteller Artikelnummer: |
CNA3670S |
Alternativnummer: |
MBL-CNA3670S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 50-260 of human FHL2 (Q14192). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC2068] |
Molekulargewicht: |
32kDa |
Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequenz: |
DCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVG |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 50-260 of human FHL2 (Q14192). |
Application Verdünnung: |
WB: WB,1:500 - 1:2000 |