EAAT2/SLC1A2 Rabbit mAb, Clone: [ARC0821], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3679S
Artikelname: EAAT2/SLC1A2 Rabbit mAb, Clone: [ARC0821], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3679S
Hersteller Artikelnummer: CNA3679S
Alternativnummer: MBL-CNA3679S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT2/SLC1A2 (P43004).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0821]
Molekulargewicht: 62kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFI
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT2/SLC1A2 (P43004).
Application Verdünnung: WB: WB,1:500 - 1:2000