Fbx32/FBOX32 Rabbit mAb, Clone: [ARC0830], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3699S
Artikelname: Fbx32/FBOX32 Rabbit mAb, Clone: [ARC0830], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3699S
Hersteller Artikelnummer: CNA3699S
Alternativnummer: MBL-CNA3699S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Fbx32/FBOX32 (Q969P5).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0830]
Molekulargewicht: 42kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Fbx32/FBOX32 (Q969P5).
Application Verdünnung: WB: WB,1:500 - 1:1000| IHC-P,1:50 - 1:200