ACTN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3718S
Artikelname: ACTN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3718S
Hersteller Artikelnummer: CNA3718S
Alternativnummer: MBL-CNA3718S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ACTN2 (NP_001094.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 104kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ACTN2 (NP_001094.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200