ACLY Rabbit mAb, Clone: [ARC0281], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3719S
Artikelname: ACLY Rabbit mAb, Clone: [ARC0281], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3719S
Hersteller Artikelnummer: CNA3719S
Alternativnummer: MBL-CNA3719S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1101 of human ACLY (P53396).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0281]
Molekulargewicht: 121kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ATPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMSM
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1000-1101 of human ACLY (P53396).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000