ALDH1B1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3725S
Artikelname: ALDH1B1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3725S
Hersteller Artikelnummer: CNA3725S
Alternativnummer: MBL-CNA3725S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 278-517 of human ALDH1B1 (NP_000683.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: NLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 278-517 of human ALDH1B1 (NP_000683.3).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200