BANF1 Rabbit mAb, Clone: [ARC2085], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3726S
Artikelname: BANF1 Rabbit mAb, Clone: [ARC2085], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3726S
Hersteller Artikelnummer: CNA3726S
Alternativnummer: MBL-CNA3726S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (O75531).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2085]
Molekulargewicht: 10kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (O75531).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200