Filamin A Rabbit mAb, Clone: [ARC0242], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3738S
Artikelname: Filamin A Rabbit mAb, Clone: [ARC0242], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3738S
Hersteller Artikelnummer: CNA3738S
Alternativnummer: MBL-CNA3738S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2548-2647 of human Filamin A (P21333).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0242]
Molekulargewicht: 281kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 2548-2647 of human Filamin A (P21333).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200