COX6A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3798S
Artikelname: COX6A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3798S
Hersteller Artikelnummer: CNA3798S
Alternativnummer: MBL-CNA3798S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2).
Application Verdünnung: WB: WB,1:200 - 1:2000|IHC-P,1:20 - 1:200|IF/ICC,1:50 - 1:200