NONO/p54nrb Rabbit mAb, Clone: [ARC0836], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3800S
Artikelname: NONO/p54nrb Rabbit mAb, Clone: [ARC0836], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3800S
Hersteller Artikelnummer: CNA3800S
Alternativnummer: MBL-CNA3800S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 372-471 of human NONO/p54nrb (Q15233).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0836]
Molekulargewicht: 54kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 372-471 of human NONO/p54nrb (Q15233).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200