Exportin 5 (XPO5) Rabbit mAb, Clone: [ARC0838], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3813S
Artikelname: Exportin 5 (XPO5) Rabbit mAb, Clone: [ARC0838], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3813S
Hersteller Artikelnummer: CNA3813S
Alternativnummer: MBL-CNA3813S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Exportin 5 (XPO5) (Q9HAV4).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0838]
Molekulargewicht: 136kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQVAIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIVVEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQTLTQNMERIFSFLLNTLQEN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Exportin 5 (XPO5) (Q9HAV4).
Application Verdünnung: WB: WB,1:500 - 1:1000| IHC-P,1:50 - 1:200